Bacterial taxon 262316
Locus MAP_2532
Protein AAS04849.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 223 aa, Gene n/a, UniProt Q73WX8
>AAS04849.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MTGLYYDPWNREIDADPYPIYQRLRNEAPLYYNERHDFWGLSRYDDVDAALRDPLRLSSAKGDILDVVKADPVMPPGVFINEDPPLHTIHRALVARAFTPKKMRTLEDKIRAFCVASLDMVADSDRFDFVEDLGAELPMRTIGMLLGIPDADQPSVREHARATLQNDTGGPMPIRKDHYFDGDMFSDYVEWRKRPEWEIDMDNARRSRTSTVRGWDSMPAIVT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 2,843,129 | 7.85 | 0.01 | ○○○○○ 2.25 | 2.247213903754717 | 24885784 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)