Bacterial taxon 262316
Locus MAP_2631
Protein AAS04948.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 186 aa, Gene n/a, UniProt Q73WM9
>AAS04948.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MVVTGPGWWNRGMTEYAAFLRGVNVGGVNLKMADVKKALTDAGFTAVRTVLASGNVLLQSKAGAAAVRAKAEAALRERFGYDAWVLVYDLDTVRRVVDGYPFEREVDGYQSYVTFVADAAVLDELAALPAGPDERIRRGPDPLGVLYWQVPKGSTLDSTIGKTMGKPRYKSSTTTRNLRTLVKVLS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 2,965,815 | 6.13 | 0.032 | ○○○○○ 1.69 | 1.6860329054765009 | 24885784 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)