Bacterial taxon 262316
Locus MAP_2842c
Protein AAS05159.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 232 aa, Gene n/a, UniProt Q73W19
>AAS05159.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MLSVIAIVPSAPVLVPELAGTAADELAELSAATLAAAALLPDRWLIIGTGAADQELGDDAVGTFAGFGMDVPVRLSPPADGRAETAPAALPLCALLGGWLRGQVQPQAAARARIYRADHDADTAVRRGRQLRAELDALPEPVGVLVVADGANTLTPAAPGGHHPGDAAAQQALDDALAGGDIAALRRLPGQILGRVAFGVLAGLAEPGPRSAKELYRGAPYGVGYFAGAWQL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 3,171,605 | 6.91 | 0.02 | ○○○○○ 1.94 | 1.9398338714870533 | 24885784 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)