Bacterial taxon 262316
Locus MAP_3143
Protein AAS05691.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 175 aa, Gene n/a, UniProt Q73V71
>AAS05691.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MSGLRVGDPADPDTDLGPLVSRRQQQRVRDYIRIGQQEGARLVVGGADMPDGLDRGWYVRPTLFAAAGNAMRIAREEIFGPVITVIPYRDDDEAVAIANDSDYGLAGSVWSDDTDRALALATRIHTGTVGVNQGYTMDPFAPFGGVKASGYGRELGPEGLDGYLDTKSIAVAASG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 3,497,810 | 7.32 | 0.015 | ○○○○○ 2.08 | 2.076506882695994 | 24885784 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)