Bacterial taxon 262316
Locus MAP_3579c
Protein AAS06129.1
hypothetical protein
Mycobacterium avium subsp. paratuberculosis K10
Length 183 aa, Gene n/a, UniProt Q73TY9
>AAS06129.1|Mycobacterium avium subsp. paratuberculosis K10|hypothetical protein
MSHPVRATAIADTDTSTRQRILAATAEVLGRNGKTKLSLSDVATQAGVSRPTLYRWFASKEELLSAFSAYERQIFESGLVKATAGLKGVDKLDAVLRFIVDYQHSYSGVRMVDVEPEHTIAQFSWVIPQMREGLQRHLPGPNAAVKAATVIRIAISHYIVRSDDADQFLAQLRHAVGIKAPTD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 3,978,153 | -3.95 | 0.035 | ●●○○○ -1.62 | -1.618043509473681 | 24885784 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)