Bacterial taxon 262316
Locus MAP_0919
Protein AAS03236.1
MoaB2
Mycobacterium avium subsp. paratuberculosis K10
Length 185 aa, Gene moaB2, UniProt Q742B8
>AAS03236.1|Mycobacterium avium subsp. paratuberculosis K10|MoaB2
MRVDEPSAAGLSELGYTVAPMETGAELVVGRALVVVVDDRAAHGDEDHSGPLVTELLTEAGFVVDGVVAVAADEVEIRNALNTAVIGGVDLVVSVGGTGVTPRDVTPEATREILDREILGIAEAIRGSGLSAGIIDAGLSRGLAGVSGSTLVVNLAGSRYAVRDGMATLNPLAAQIIGQLSSLEI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 952,268 | 6 | 0.034 | ○○○○○ 1.64 | 1.643255046815985 | 24885784 |
| Mouse (Mus musculus C57BL/6) | spleen | BTO:0001281 | 1 month | 952,776 | 7.92 | 0.0099 | ○○○○○ 2.27 | 2.2704208257273946 | 24885784 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)