Bacterial taxon 431947
Locus PGN_0448
Protein WP_005875129.1
ABC transporter ATP-binding protein
Porphyromonas gingivalis ATCC 33277
Length 219 aa, Gene n/a, UniProt B2RHX2
>WP_005875129.1|Porphyromonas gingivalis ATCC 33277|ABC transporter ATP-binding protein
MIDIKGIHKTYPGAQPLHVLKGIDLHIAKGEMVSIMGASGSGKSTLLNILGVLDTYDEGEYRLHGELIRNLSENRAAEIRGRLIGFVFQSFNLISFKNAVENVALPLYYQGMSRRKRNEMAMEYLRRVGLEDWADHLPNELSGGQKQRVAIARALAAKPQVILADEPTGALDSVTTVEVMELLRSVNRDGITMVIVTHEQSVADSTDRIIHIKDGIIGA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.46 | <1e-323 | ●○○○○ -0.04 | -0.03651750942171733 | 28900609 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)