Bacterial taxon 431947
Locus PGN_0205
Protein WP_012457326.1
AraC family transcriptional regulator
Porphyromonas gingivalis ATCC 33277
Length 299 aa, Gene n/a, UniProt B2RH79
>WP_012457326.1|Porphyromonas gingivalis ATCC 33277|AraC family transcriptional regulator
MSIHICQPVSPKEKPNGILNNSRPTTALSGLPELHTVGQGADLEIWTKDSHALLFLLKGEPAVFVGPESGNSQLSGDNVVLLAANLRIRLRAEKGPATLICFYFHPTLHLCLGICPSSGNTKECRRRTEIVHISSLQRETMVNSWLHSVMGYLSEMPASSEIFELKLRELFCIFRSRYEKPLLDNFLSSFHCQNKGFRAFVFRHHLECRSAEELAAKMNLSLSSFKRHFNQEFGCPPLKWMHEERARHVYTDLADPSLSLKAIAEKNLFSSVSYLCAFCRKMLGNTPLQLRKAMGQQPK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.04 | 0.0026 | ○○○○○ 0.92 | 0.9156098714955748 | 28900609 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)