Bacterial taxon 431947
Locus PGN_1533
Protein WP_012458351.1
carbonic anhydrase
Porphyromonas gingivalis ATCC 33277
Length 242 aa, Gene n/a, UniProt B2RL07
>WP_012458351.1|Porphyromonas gingivalis ATCC 33277|carbonic anhydrase
MKKIVLFSAAMAMLIACGNQTTQTKSDTPTAAVEGRIGEVLTQDIQQGLTPEAVLVGLQEGNARYVANKQLPRDLNAQAVAGLEGQFPEAIILSCIDSRVPVEYIFDKGIGDLFVGRVAGNVVDDHMLGSLEYACEVSGSKVLLVLGHEDCGAIKSAIKGVEMGNITSLMEEIKPSVEATQYTGERTYANKEFADAVVKENVIQTMDEIRRDSPILKKLEEEGKIKICGAIYEMSTGKVHFL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.95 | 0.013 | ○○○○○ 0.31 | 0.31025092606622173 | 28900609 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)