Bacterial taxon 431947
Locus PGN_0598
Protein WP_012457633.1
conjugative transposon protein TraJ
Porphyromonas gingivalis ATCC 33277
Length 328 aa, Gene traJ, UniProt B2RIC2
>WP_012457633.1|Porphyromonas gingivalis ATCC 33277|conjugative transposon protein TraJ
MNFDNLHQLLANLYQEMLPLCSDMIGVAKGLAGLGALFYVAYRVWQALARAEPIDVFPLLRPFAIGLCILFFPTLVLGSIHAVMSPIVKGSHTVMESQITDVQALQQQKDQLRYEARLREGKAWLVDDEAYDQKMKDLGIMDTPEIIGMWGERLWYDIKTWFREVVRNFFELLFHAAALSIDTIRTFFLIVLSILGPIAFAFSVYDGFQATLTQWLARYIGVYLWLPVADLFSAVLSKIQALMLQQDIALLQDPNYVPDGSNGLYIVFLVIGIVGYFTIPTVAGWIIHSGGAGAYGSAVNKTAGKAGGVASGVAGATLGNVGGRLLGK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.18 | 3.4e-5 | ○○○○○ 0.15 | 0.15006617613306122 | 28900609 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)