Bacterial taxon 431947
Locus PGN_1961
Protein WP_012458644.1
CRISPR-associated protein Cas4
Porphyromonas gingivalis ATCC 33277
Length 169 aa, Gene n/a, UniProt B2RM84
>WP_012458644.1|Porphyromonas gingivalis ATCC 33277|CRISPR-associated protein Cas4
MIITGTHFNYHQVCRRKLWLFSAGITMEHTSDLVYEGKLIHETTYQQRPERYQELELDGIKIDFYDAKNRVVHEVKKSNKISPAHRLQLLYYLYVLERNGVLGATGILEYPTLRKKEEVILSDIDRERIREIEQEILQIISHEDCPPVIDSGICKNCSYYEFCFSGEEQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -4.75 | <1e-323 | ○○○○○ 1.11 | 1.1136569812354096 | 28900609 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)