Bacterial taxon 431947
Locus PGN_1639
Protein WP_005874159.1
cupin domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 109 aa, Gene n/a, UniProt B2RLB3
>WP_005874159.1|Porphyromonas gingivalis ATCC 33277|cupin domain-containing protein
MTKETYPKATVLDISASVEYSDGGIISKQVLKNEVGNITLFSFDQGQGLSEHTAPFDAFVQILEGEAEIRIGGQPLLLKAGRSVIMPANVSHALHATKRFKMLLTMIRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.12 | <1e-323 | ○○○○○ 0.2 | 0.19587220451881845 | 28900609 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)