Bacterial taxon 431947
Locus PGN_1975
Protein WP_004583671.1
Cys-tRNA(Pro) deacylase
Porphyromonas gingivalis ATCC 33277
Length 169 aa, Gene n/a, UniProt B2RM98
>WP_004583671.1|Porphyromonas gingivalis ATCC 33277|Cys-tRNA(Pro) deacylase
MPKTNVARLLDAAHITYELIPYEPDERDLSAVHVAEQLGEDVRQVFKTLVLRGNKTGLLVCIVPGDEEVDLKLAARASDNKSVEMIRQSELLPLTGYIRGGCSPIGMKKAYPSYIHHTCMAFPYIYVSAGVRGLQLRIAPADLLAYTGAEPACLCGATTEEKSIINQTL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.12 | 5.7e-15 | ●○○○○ -0.48 | -0.4776925831892736 | 28900609 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)