Bacterial taxon 431947
Locus PGN_1745
Protein WP_010956414.1
cytochrome c nitrite reductase small subunit
Porphyromonas gingivalis ATCC 33277
Length 203 aa, Gene n/a, UniProt B2RLL9
>WP_010956414.1|Porphyromonas gingivalis ATCC 33277|cytochrome c nitrite reductase small subunit
MARLKVVFERFGRKLLPSFRHKVFALVLVGVFVGLGAYLVYMSKAYSYLSDDPRVCINCHVMGPYYATWQHSSHAMRATCNDCHVPHNSIFSKYYFKASDGLRHSYVFTMRNEPQRMQAISASQAVIYDNCVRCHAQLNQEFVRTGMLTRADIRTAEEKACWDCHRDVPHGGKNSLSATPNGIISYPKSPVPQWLRAYISKKK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.65 | <1e-323 | ●○○○○ -0.83 | -0.8334263093497284 | 28900609 |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)