Bacterial taxon 431947
Locus PGN_0092
Protein WP_004366620.1
DNA-binding protein
Porphyromonas gingivalis ATCC 33277
Length 100 aa, Gene n/a, UniProt B2RGW6
>WP_004366620.1|Porphyromonas gingivalis ATCC 33277|DNA-binding protein
MDNDVKTKNNEEIAHFLNASDRMIKGIDVLRKKNRPLLNGHRYLTDDELSRLLHINRRTLQDYRNMGRISFVKLGGKVLYREEDVEKLLQENYRPRFEKP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.43 | 1.5e-9 | ●○○○○ -0.69 | -0.6862171808380786 | 28900609 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)