Bacterial taxon 431947
Locus PGN_1308
Protein WP_012458170.1
DNA-binding protein
Porphyromonas gingivalis ATCC 33277
Length 310 aa, Gene n/a, UniProt B2RKD2
>WP_012458170.1|Porphyromonas gingivalis ATCC 33277|DNA-binding protein
MNLFSNLLFRFDVRRLSEDTLKAIYSLEEDGLPVNADRLVALTGLKISNQQYILDLLHKQGYCLPPDSHLTESGRKYALKVIRRHRLLEKYLSEHSGYEPSEWHTQACKEEHDLSDEEQERIAVRLGNPLFDPHGDPIPTEEGEVQSVEGIHADELPDDSYVRVIHIEDEPADLYRQIETIGFFRGAVFHLLRTDTDGVHLSFEGEQFFLPQEAAHNLTVMPCTDKGMIDLAQKTVKLTTLRQGEEATIAGISKACRGANRRRLLDLGFVRGSRIAIDLTSPLGNPTAYVVRGTAIALRRDQARYILIYR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.35 | 1.5e-9 | ○○○○○ 0.04 | 0.038977074465386716 | 28900609 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)