Bacterial taxon 431947
Locus PGN_0286
Protein WP_012457395.1
DUF1661 domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 107 aa, Gene n/a, UniProt B2RHG0
>WP_012457395.1|Porphyromonas gingivalis ATCC 33277|DUF1661 domain-containing protein
MVREAKNLRARTKKISLHIFRKHAPQSEDFRCVFLRQQVIDRSIEAMAKPYDFHIVWELSYNHVFTIHPRHIILELPPVYPDTALVPFFIMYFSFFGHMISVEYIFH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -4.55 | 0.00032 | ○○○○○ 1.25 | 1.2466840533484533 | 28900609 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)