Bacterial taxon 431947
Locus PGN_0561
Protein WP_080504398.1
DUF1661 domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 48 aa, Gene prtT, UniProt B2RI85
>WP_080504398.1|Porphyromonas gingivalis ATCC 33277|DUF1661 domain-containing protein
MLLLKTRFVNFFILAWEVKNSHATTKKISRHFFREYAPQSEHFRFVFF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.89 | <1e-323 | ○○○○○ 0.35 | 0.3497692841199347 | 28900609 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)