Bacterial taxon 431947
Locus PGN_1790
Protein WP_004583522.1
DUF2023 family protein
Porphyromonas gingivalis ATCC 33277
Length 117 aa, Gene n/a, UniProt B2RLR4
>WP_004583522.1|Porphyromonas gingivalis ATCC 33277|DUF2023 family protein
MDTQTLNSDLRVFMHHIYEFEKGVRSMVLATLANDDIPYAEERLRSRQIPYFAQPTPNTERTNLFFGCKECMEAIRLFVSGRSLNSLTPEEDFIIGAMLGYDICRQCERYCRRKSNS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -8.23 | 1.4e-10 | ●●○○○ -1.22 | -1.2198849095480675 | 28900609 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)