Bacterial taxon 431947
Locus PGN_1348
Protein WP_012458207.1
DUF2807 domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 246 aa, Gene n/a, UniProt B2RKH2
>WP_012458207.1|Porphyromonas gingivalis ATCC 33277|DUF2807 domain-containing protein
MRKKIFAGLVGLIGTALIAGACNIKFDNKGKTITPKGDAITETRNIGTFDKIDVEDAFNIHYKAGIPTDGLTIEAAPNLMEYIVTEVTDGELSIRLKDRYSIHDGKIVITVGSPTLKAVEMSGACALNVEGELTGDRLDLDLSGASSVNLTGRLKALDINASGASGIKLKGSGEEFTLSCSGAVGCDASDFITQRTEVSVSGTASVKINASESVRGDLSGISSLENYGASSNDEVTTSGMSSYKHK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.03 | 1.9e-15 | ●○○○○ -0.42 | -0.4181822248017345 | 28900609 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)