Bacterial taxon 431947
Locus PGN_0138
Protein WP_004584701.1
DUF3127 domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 139 aa, Gene n/a, UniProt B2RH12
>WP_004584701.1|Porphyromonas gingivalis ATCC 33277|DUF3127 domain-containing protein
MDIQIQGQLIQILPLNSGVGKASGKEWKKQEYILETLDQYPRKIHFSVWGDRIDPSYQVGDQVTVWVDIESREFNGRWYTDVKAWRMERGYIGQQGQQQLPQEMPAAGAPTFPTQQPSMPSQPATGWASNADAGDDLPF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.16 | 9.3e-9 | ○○○○○ 0.17 | 0.16661468017340267 | 28900609 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)