Bacterial taxon 431947
Locus PGN_0689
Protein WP_004585199.1
DUF3276 family protein
Porphyromonas gingivalis ATCC 33277
Length 127 aa, Gene n/a, UniProt B2RIL3
>WP_004585199.1|Porphyromonas gingivalis ATCC 33277|DUF3276 family protein
MTDKLPFALYSRCVKAGKRFYYIDAKRDSKGNDYLVITESNSAEEGSAMTRHKVFLYREDFAKFTEAFLDVLQSFEKRSGVSGCEQAIGLSELEQSLSDMTTGVEGLAESSDSILEEDEPLKIDFDF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.51 | 0.0003 | ●○○○○ -0.74 | -0.7380898529687373 | 28900609 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)