Bacterial taxon 431947
Locus PGN_0592
Protein WP_012457627.1
DUF3872 domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 145 aa, Gene traQ, UniProt B2RIB6
>WP_012457627.1|Porphyromonas gingivalis ATCC 33277|DUF3872 domain-containing protein
MKRKVLNAIWVTELLALAMFCLSACNHELDIQQAYPFTVETMPVQKNIIKGQTVEIRCTLKRQGKFANTRYSIRYFQPDGKGRLKMDDGTVFKPNERYPLTKEKFRLYYTSRTTGQQVIDVYIEDSFGQVQQFSLSFNNDNNKEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.57 | <1e-323 | ●○○○○ -0.78 | -0.7826389091469922 | 28900609 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)