Bacterial taxon 431947
Locus PGN_0596
Protein WP_012457631.1
DUF3989 domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 87 aa, Gene n/a, UniProt B2RIC0
>WP_012457631.1|Porphyromonas gingivalis ATCC 33277|DUF3989 domain-containing protein
MIRNSIAILKKRTERYVRSRLEQMSPQSRIRTVLLLLVLFGMLAFYMTVSSLYELGKGKRNISIERIRYLKPESQTDSIKTIKLIPR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.19 | <1e-323 | ○○○○○ 0.15 | 0.14597620076006745 | 28900609 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)