Bacterial taxon 431947
Locus PGN_1495
Protein WP_012458318.1
DUF4248 domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 133 aa, Gene n/a, UniProt B2RKX0
>WP_012458318.1|Porphyromonas gingivalis ATCC 33277|DUF4248 domain-containing protein
MITRCEKYRQIGAKCIPLYLSAGRCSDAFFSLFGIHHYSIKTHTNMKVKSNGASAREDVFPFRVHRVKEVAVRYFPHLTPNSGTRALRRIIYGDQDLLNSMREHGYALGQRSLTPAMLNVLTAYLGSPEDFCP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.72 | 0.037 | ●○○○○ -0.88 | -0.8798002672959482 | 28900609 |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)