Bacterial taxon 431947
Locus PGN_0384
Protein WP_012457467.1
DUF695 domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 145 aa, Gene n/a, UniProt B2RHQ8
>WP_012457467.1|Porphyromonas gingivalis ATCC 33277|DUF695 domain-containing protein
MKLTDRWFTSISEDEKGNIVFVNGRLELDEFRLSGKLKIRIEIRWSYEADEQGLPTESAGKQIEEIELLIRKAMEKDKLAIMTGNYTGGGTKYWVYYARTERVFGERLNEVLAPYETLPLEIECEVDTDWEEYLDMLSMKDENSI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.64 | 3.3e-6 | ○○○○○ 0.52 | 0.5181814028162952 | 28900609 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)