Bacterial taxon 431947
Locus PGN_0303
Protein WP_004583838.1
DUF805 domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 179 aa, Gene n/a, UniProt B2RHH7
>WP_004583838.1|Porphyromonas gingivalis ATCC 33277|DUF805 domain-containing protein
MRWFILCLRKYVDFKGRARRKEFWLFTLFYLIALVIPPAVIIPIAVIYRHTIDIALCIRICVVVEILVIFSLLLPAYAVTVRRLHDTNRSGLWVIASIVPRVLAEGLGVIFGQKWLIQIAEGEFPTLLLINMFLLLIDLCVSILILVMMCERGTEGENRFGPDPLSDGREVLMESEPGK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.02 | <1e-323 | ○○○○○ 0.26 | 0.2611593489521113 | 28900609 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)