Bacterial taxon 431947
Locus PGN_0314
Protein WP_012457418.1
formate/nitrite transporter family protein
Porphyromonas gingivalis ATCC 33277
Length 261 aa, Gene n/a, UniProt B2RHI8
>WP_012457418.1|Porphyromonas gingivalis ATCC 33277|formate/nitrite transporter family protein
MVRNPEEVLEQTYSMAAGKYAKTWYQIFWLGIMAGAYIAIGGFLSLLVGKGFPEMAEANPGLAKLLSGAMFPVGLILVVLTGAELFTSNNAVLIPAAVKSRIPRLFPLKLWSVVYVANFIGAFLFTYFLVHLAGFTDADPWHSAIVHLSEDKTSLPFHVAFLRGIGANWLVCLAVWLGLSAHDFTGKMFGIWWPVMAFVAMGFEHSIANMFYIPLGILQGASVSWGSFVIDNLLPVTIGNIVGGALFVGFFHVHIFDRGGK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.55 | <1e-323 | ●○○○○ -0.76 | -0.7643602724886664 | 28900609 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)