Bacterial taxon 431947
Locus PGN_0168
Protein WP_012457298.1
Gfo/Idh/MocA family oxidoreductase
Porphyromonas gingivalis ATCC 33277
Length 323 aa, Gene wbpB, UniProt B2RH42
>WP_012457298.1|Porphyromonas gingivalis ATCC 33277|Gfo/Idh/MocA family oxidoreductase
MHNFAIIGVAGYIAPRHLRAIKDTGNRLVSAMDKFDSVGIMDSYFPKAAFFTEQELFDRHNSKLRGTDQAIDHVSVCTPNYLHDAHCRYGLRLGADVICEKPLVLNPWNIDALQEIEQETGHRIYNILQLRLHESIVALKRKIESGPADKIYDVTLTYITSRGNWYYTSWKGDERKSGGIATNIGVHFYDMLSWIFGSVRHNVVHVYEHDRAAGYLELERARVRYFLSINEELLPENAVQGEKRTFRTIEIDGESFEFSEGFTELHTESYRRILAGEGFGLDEARNSIQIVHDIRNASPVGLKGEYHPFARLPLASHPFGWRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.48 | <1e-323 | ●○○○○ -0.72 | -0.7222323440681866 | 28900609 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)