Bacterial taxon 431947
Locus PGN_1521
Protein WP_012458340.1
GLPGLI family protein
Porphyromonas gingivalis ATCC 33277
Length 299 aa, Gene n/a, UniProt B2RKZ5
>WP_012458340.1|Porphyromonas gingivalis ATCC 33277|GLPGLI family protein
MKTNKTLSMKRTLLFLASCFFMSMSFIQAQVPRIVGAEGMPVDTVPKRVEDYTKRRFFYKVSFVKDTTRRDKETQAQCVLEIGQRGSCFKDFYEYAADSVNDAVARKKGTAMEIFSKAYDYVKKTQWRTPVLKGYPSGQDYHQYGDPIVGSYEYGCPSPSFDWQIGEETKEIMGYTCRKATCHHSGRDYTAWYAEDIALSDGPYIFRGLPGLIVAIGSDDGEYVFELNGMQEITFPSPIYFKKNAFTKVGSREEMRKTIRNIHEHYAEVVANSPAFVNSPIPVDFSHLPPQPFNPLEKE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.66 | 0.014 | ●○○○○ -0.17 | -0.16851322326459894 | 28900609 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)