Bacterial taxon 431947
Locus PGN_1522
Protein WP_043876329.1
GLPGLI family protein
Porphyromonas gingivalis ATCC 33277
Length 315 aa, Gene n/a, UniProt B2RKZ6
>WP_043876329.1|Porphyromonas gingivalis ATCC 33277|GLPGLI family protein
MCLAGGKCRVVFVNFVHPQSLTASLMKKILSTVILICILSSFGVAQVGVPRIDDMRGMRMDTVSKKIKDYAQRRFFYKVVFVEDTLKREKKTEAQCVLEIGRHGSSFMDLYQLAWDSLSDAVTRRKGSMMELFTEGAGLVKKIKWRIVLLKGYPEGTDRHQQEVPLTGRYEYECPSPSFDWQIGEETEEIMEYTCRKATCRHSGRDYTAWYAEDIALSDGPYIFRGLPGLIVAIASDDGEYAFKLNGMQEITFSSPIYLYDKKVQKYSREEVRKIIRNISENYSETIINQGRFRLKNPEDIQRIRNLPYNPLEKE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.43 | 0.00018 | ○○○○○ 0.66 | 0.655462057468905 | 28900609 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)