Bacterial taxon 431947
Locus PGN_1633
Protein WP_004584814.1
glutamate formimidoyltransferase
Porphyromonas gingivalis ATCC 33277
Length 300 aa, Gene n/a, UniProt B2RLA7
>WP_004584814.1|Porphyromonas gingivalis ATCC 33277|glutamate formimidoyltransferase
MALSRIMECVPNFSEGRDKEKIEKIVNPFRTREGVKLLNYSNDEDHNRLVVTVVGEPEPLREAVLEAVGIAVELIDLTKHTGQHPRMGAVDVIPFIPIKNVTAEDADALAKEVGRTIGEKYGVPVFLYEKSATAPHRENLAKIRKGEFEGMAEKIHEADWHPDFGPADRHPTAGTVAVGARMPLVAYNVNLNTNDLSIADAIAKKVRFLGGGLRFCKAMGVELTDRGIVQVSMNLTDFTKTAVYRAHEMVRMEAARYGVSVVGSEVIGLVPMQALIDCAEYYLGIENFSMDQILESRIME
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.88 | 0.0042 | ●○○○○ -0.32 | -0.31601362348507944 | 28900609 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)