Bacterial taxon 431947
Locus PGN_0690
Protein WP_021678821.1
HD domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 183 aa, Gene n/a, UniProt B2RIL4
>WP_021678821.1|Porphyromonas gingivalis ATCC 33277|HD domain-containing protein
MMNPISIINKYYTEGTNQYHILVEHSRDVAALALRIVEIHPELQADRLFVEEAAMLHDIGIFLTDAESIACFGKEPYILHGYMGANILRKEGYPRHALVCERHTGSGLTSEDIAARQIALPPGIYTPQSIEEKIVCYADKFFSKTKLHRQKKLEDVRRSMLSYGADSLHRFDEMHALFKIPLG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.81 | <1e-323 | ○○○○○ 0.4 | 0.40162814428964255 | 28900609 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)