Bacterial taxon 431947
Locus PGN_1415
Protein WP_012458253.1
histidinol phosphate phosphatase
Porphyromonas gingivalis ATCC 33277
Length 172 aa, Gene n/a, UniProt B2RKN9
>WP_012458253.1|Porphyromonas gingivalis ATCC 33277|histidinol phosphate phosphatase
MIGYVSKQSKVANKDGKRVWYPQTVASGRVIDTKRVARELAARSGASEGDVHGILHDLGLVLRDYLSTGARVVLDGVGSFRITANARGKGVEKKEDVSPRQFNSIRVAFYPEKRVNQSTHTTNVTLIDPNLRFVYVKNPKDAAGNASSQTNTPDSPTPPDGGGEQGSQGGGL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7 | 0.035 | ●○○○○ -0.4 | -0.39950917857874424 | 28900609 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)