Bacterial taxon 431947
Locus PGN_1631
Protein WP_012458422.1
histidinol phosphate phosphatase
Porphyromonas gingivalis ATCC 33277
Length 172 aa, Gene n/a, UniProt B2RLA5
>WP_012458422.1|Porphyromonas gingivalis ATCC 33277|histidinol phosphate phosphatase
MSLKYVIKKSVAKIGPKAGQTIYYAQPAAQDSVTFHSLCKRIAEESALTSADVKGILDRLVNILSEELPNGKTVRIGELGSFRLSFGSKQLDDPKNFSVDQIQKHRLVFIPSAELKSIPARGKLRPGSSALAFDYERVEPQPKKKPGTGDNQTPSPSTPGGGGGQGGTGGGL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -4.66 | 0.0098 | ○○○○○ 1.17 | 1.169780790608592 | 28900609 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)