Bacterial taxon 431947
Locus PGN_0424
Protein WP_012457496.1
HIT family protein
Porphyromonas gingivalis ATCC 33277
Length 129 aa, Gene n/a, UniProt B2RHU8
>WP_012457496.1|Porphyromonas gingivalis ATCC 33277|HIT family protein
MTIFSRIIAGEIPCHKIAESDKFFAFLDINPLALGHTLVVPKQEVDYIFDMNDADLGEMTIFAKQVAAAIKRAFPCRKVGMTVIGLEVPHAHIHLVPMQSEADMHFGRQKLTPSQEELVAAAEKIRAVF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.29 | 4.4e-10 | ○○○○○ 0.08 | 0.08148085353536688 | 28900609 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)