Bacterial taxon 431947
Locus PGN_0036
Protein WP_012457186.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 87 aa, Gene n/a, UniProt B2RGR0
>WP_012457186.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MRPGNTSACNNFPVFLQDMLNKLEEKKVGLVRADSCFCNKQVIESLQKQKIHYIIAARLTSTVKICLLRLFAVVAETVQRRKIGLGA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -4.42 | 0.00016 | ○○○○○ 1.34 | 1.3355600567586468 | 28900609 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)