Bacterial taxon 431947
Locus PGN_0093
Protein WP_012457235.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 121 aa, Gene n/a, UniProt B2RGW7
>WP_012457235.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MKREIITIGQKGKVHIPTATPVWMSACEIASLFGVFSSKVNSHIKSIFKEGLLREDEVMQTLLFRDGSVDLYNLEMITMLSFRFASPQAKSFRQWIIGRLTEKKRTSPPLLVCYGKGGWYN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.02 | 1.4e-6 | ●○○○○ -0.41 | -0.40779217173706034 | 28900609 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)