Bacterial taxon 431947
Locus PGN_0150
Protein WP_077094377.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 64 aa, Gene n/a, UniProt B2RH24
>WP_077094377.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MRSKIFVFVTSKNVVRKLFRFGVGSEKFTHHDEKNLVPFSRKTQTAIGRFLARGWPEIGSPKRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -4.83 | 0.045 | ○○○○○ 1.06 | 1.0618042476425515 | 28900609 |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)