Bacterial taxon 431947
Locus PGN_0318
Protein WP_080504391.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 135 aa, Gene n/a, UniProt B2RHJ2
>WP_080504391.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MFVAPQNVARKFFASGSGNEKFSRHNETILAPFFQKTRAAIGAFLVRVSMTAGYRHWRDRIDVGALWLHVLFLYFCGERRRTLFARHLHSSNTFICFQQNESSTNHRSRHRSGRSIGYYSCSAIGYRPVRRSRRL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.54 | 0.00032 | ●○○○○ -0.09 | -0.09071838846011814 | 28900609 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)