Bacterial taxon 431947
Locus PGN_0322
Protein WP_005874255.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 297 aa, Gene n/a, UniProt B2RHJ6
>WP_005874255.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MKKAFLLGLAGIFFAQTAIAGNAAQGVPDTTVRIEDKVLVINETEDDIDIMLYRYNPDGTRGRSEQVFKGVYLKGRSIEQRFRNTIFDVPLNLTRSNKCSGDKRIRSIGSGSFKLGFVNLTGSAGEHINASSSLRYTLGLMSVSYRLNDWLVIAPNLDIEFNSIHLKNNYSFQDVEGLTQVLPAAEGVTYDNSRLHITYMNVAVPFMMKKCRSSFSLYAAPVLKFKTASSSKVWLPDNKSHQKHGRDLNLNPIVLEARVGINYSAFNLYGSYTLTPLFRSGKGPDTRMFAIGFGFGF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.93 | 3.9e-11 | ○○○○○ 0.32 | 0.321941107810943 | 28900609 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)