Bacterial taxon 431947
Locus PGN_0982
Protein WP_070105217.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 116 aa, Gene n/a, UniProt B2RJF6
>WP_070105217.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MPLFYHCPNRPFSACDLYRNEFRSMYKLKTIYIQIENDLYIYRKLFVYRSLSSLLKVMFLPEKHPLFTFLTSKSSSFQVLIWNHSKLIFVVENFFRAYFGLSINTDKGLYFAFRSI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -6.93 | 0.02 | ●○○○○ -0.35 | -0.35084581207629817 | 28900609 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)