Bacterial taxon 431947
Locus PGN_1435
Protein WP_004585076.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 71 aa, Gene n/a, UniProt B2RKQ9
>WP_004585076.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MTTIFLASLLLVGLAFVLLGIRVFFCRGGKFPQTHVGSNKAMQDRGIGCHTAQHFEAQHHRNLEDRIKELE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -4.78 | 2.8e-13 | ○○○○○ 1.09 | 1.0902442642953285 | 28900609 |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)