Bacterial taxon 431947
Locus PGN_1754
Protein WP_012458507.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 59 aa, Gene n/a, UniProt B2RLM8
>WP_012458507.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MDLKKVNGILTIVFYLLLVLTVAMFLFYRQTEQRWLYLIPGVVAVAVRVTGYFISSFKR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -1.34 | <1e-323 | ○○○○○ 3.4 | 3.4016075723674644 | 28900609 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)