Bacterial taxon 431947
Locus PGN_1965
Protein WP_012458648.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 195 aa, Gene n/a, UniProt B2RM88
>WP_012458648.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MEDKIFFVVHYTGPFGYIKPWSAVRDGETYSQQFLTPSIIEGMEKKLFPEMLIKKGIHKIARHKLSCMSMSVQQEKTQTQAWEGKGKGKGRTYTRPQSILKRGVMLHPSLYLAFTSEEDAVIAARQHLCLCRNEDVVLPDTEILKMDEETFNALPGFELRFGKDYPDAFMVGFNRFDENTPMYGRIEIGGEAILQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.36 | 2.6e-12 | ●○○○○ -0.64 | -0.6365733029943869 | 28900609 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)