Bacterial taxon 431947
Locus PGN_1984
Protein WP_005874429.1
hypothetical protein
Porphyromonas gingivalis ATCC 33277
Length 73 aa, Gene n/a, UniProt B2RMA7
>WP_005874429.1|Porphyromonas gingivalis ATCC 33277|hypothetical protein
MKWRIRVHLTLAVLLCLVGLLLLFIGFFVPPVGEIDSSVLIAYGEVSTFAGSLLGIDYRYRYKYGGYGKESDP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.67 | 5.2e-12 | ○○○○○ 0.49 | 0.494491648398595 | 28900609 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)