Bacterial taxon 431947
Locus PGN_0929
Protein WP_080504411.1
KTSC domain-containing protein
Porphyromonas gingivalis ATCC 33277
Length 69 aa, Gene n/a, UniProt B2RJA3
>WP_080504411.1|Porphyromonas gingivalis ATCC 33277|KTSC domain-containing protein
MERQIVSSSNIASIGYDDTTSTLEIEFLNGSVYHYYDVPHREYQGLMQAESHGKYLAANIKGKYRYSKV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -7.25 | 2.1e-11 | ●○○○○ -0.56 | -0.5640709501146214 | 28900609 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)