Bacterial taxon 431947
Locus PGN_1119
Protein WP_004585532.1
large-conductance mechanosensitive channel protein MscL
Porphyromonas gingivalis ATCC 33277
Length 139 aa, Gene mscL, UniProt B2RJU3
>WP_004585532.1|Porphyromonas gingivalis ATCC 33277|large-conductance mechanosensitive channel protein MscL
MKKFIQDFKAFALKGNVVDMAVGVIIGGAFGKIVTSLVNDIMMPPISLLTGGVNFTDLKLVLSKAVVEGGEVVKPEVSWNYGNFIQTTVDFLILAFVIFLMIKAIMAAKRKEEEAPAAPAPTPPEIELLTEIRDLLKKQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.5 | 1.7e-7 | ○○○○○ 0.61 | 0.6116915079504462 | 28900609 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)