Bacterial taxon 431947
Locus PGN_0491
Protein WP_012457551.1
low molecular weight phosphotyrosine protein phosphatase
Porphyromonas gingivalis ATCC 33277
Length 167 aa, Gene n/a, UniProt B2RI15
>WP_012457551.1|Porphyromonas gingivalis ATCC 33277|low molecular weight phosphotyrosine protein phosphatase
MKPHKILFVCLGNICRSPSAEAVFRSYVEEQGYADRFHIDSAGLSNYHQGEKADARMRAHAARRGYDLTSLSRPVEYEDFERFDYIIGMDFANRERLQELAPSEEAAAKIRLMTDFSSSGIHDHVPDPYYGGASGFELVLDILEECTAGLFSYLTEPHDNSSQSACD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.78 | <1e-323 | ○○○○○ 0.42 | 0.4226146299198095 | 28900609 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)