Bacterial taxon 431947
Locus PGN_0236
Protein WP_039417038.1
membrane protein
Porphyromonas gingivalis ATCC 33277
Length 191 aa, Gene n/a, UniProt B2RHB0
>WP_039417038.1|Porphyromonas gingivalis ATCC 33277|membrane protein
MQMRTFRVVAIVSLIFSSWMTLTAQKNSWWVGAHAGREYFNNTSEDMKKGWNTGVVLRYYFSDRIYSLATVNYGFTSSLSPSGYFDELGNSPDARFRRHSILPAVGLGYEFLQGDFYSCYAQGGVGYGMEYNSVSYPQEYDVSVKRFGWLAELGGDYFLRDNLSLGISVAHLRVGWRNNWTANIKLSICLL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | skin | BTO:0001253 | 1day-14days | not available in this study | -5.68 | 3.4e-5 | ○○○○○ 0.49 | 0.48671591366804884 | 28900609 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)